Subnuclear Compartments Prediction System (Version 2.0)


Developed by Zhengdeng Lei and Yang Dai
Laboratory of Computational Functional Genomics, Department of Bioengineering
University of Illinois at Chicago

References:
[1] An SVM-based system for predicting protein subnuclear localizations
BMC Bioinformatics 2005, 6:291
Supplementary material: supplementary.pdf    dataset    source code [perl]
[2] Assessing protein similarity with Gene Ontology and its use in subnuclear localization prediction
BMC Bioinformatics 2006, 7:491

The system predicts one of the following localizations in cell nucleus:
[1]PML BODY;
[2]Nuclear Lamina;
[3]Nuclear Speckles (Nuclear Splicing Speckles);
[4]Chromatin;
[5]Nucleoplasm (Nuclear diffuse);
[6]Nucleolus.
Please visit Nuclear Protein Database by Dr. Wendy Bickmore et. al. for more information.

Input your query protein sequences:


    
Accepted format:
  • 1. FASTA format
    Example:
    >Q93068;
    MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
    SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
    >P13641;
    MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
    RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

  • 2. Sequence (only for one sequence)
    Example:
    MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ


  • Your e-mail address: (optional)


    Nucleus domains illustration reproduced by permission of Dr. David L. Spector
    Spector, D.L. 2001. Nuclear domains. J. Cell Science 114, 2891-2893.
    If you have any question, contact me zlei2@uic.edu